PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_AF9357B4C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 278aa    MW: 29968.6 Da    PI: 6.8526
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_AF9357B4C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-131563148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                           +g W++eEd++l d + ++G  +W+t++ +   + R +k+c++rw +yl
  Traes_2AL_AF9357B4C.1 15 KGLWSPEEDQKLRDFIVRYGHSCWSTVPVKAAgLQRNGKSCRLRWINYL 63
                           678********************************************97 PP

2Myb_DNA-binding513.4e-1670114248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            g ++ eE+e    +++ lG++ W++Ia++++ gRt++++k++w++yl
  Traes_2AL_AF9357B4C.1  70 GMFSREEEETVMSLHATLGNK-WSLIAQHLP-GRTDNEVKNYWNSYL 114
                            56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8621063IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-201066IPR009057Homeodomain-like
SuperFamilySSF466893.48E-2713110IPR009057Homeodomain-like
SMARTSM007177.5E-101465IPR001005SANT/Myb domain
PfamPF002494.9E-111563IPR001005SANT/Myb domain
CDDcd001671.09E-91863No hitNo description
PROSITE profilePS5129424.34764118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2567117IPR009057Homeodomain-like
SMARTSM007172.6E-1368116IPR001005SANT/Myb domain
PfamPF002494.0E-1570114IPR001005SANT/Myb domain
CDDcd001671.13E-1172114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGCKSCQKPK AQHRKGLWSP EEDQKLRDFI VRYGHSCWST VPVKAAGLQR NGKSCRLRWI  60
NYLRPGLKHG MFSREEEETV MSLHATLGNK WSLIAQHLPG RTDNEVKNYW NSYLKKRVEG  120
ARAPAKSAGS DAPRSPTPSE SGRERCTVNQ PSNSGSSGPL ESSSTADESS SLTVPGTAAS  180
IRPHAPVLPK VMFADWLDMD MDYGTGLMAP SALDAAFDGS PAQQGASVST TVDGRCDAVD  240
SLHGIGDGGI CWEFEADMQG GGAGFCDLLS MSEFLGIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26151197109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3705130.0AK370513.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2111O05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580215.11e-143PREDICTED: transcription factor LAF1-like
TrEMBLW5AVZ50.0W5AVZ5_WHEAT; Uncharacterized protein
STRINGMLOC_73614.11e-167(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.14e-60myb domain protein 19
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]